SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1128_internal:A_SariMSG_c5840_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106710707_isoform_X4_[Papilio_machaon]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006359 P regulation of transcription by RNA polymerase III
GO:0007165 P signal transduction
GO:0007218 P neuropeptide signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016363 C nuclear matrix
GO:0016607 C nuclear speck
GO:0030838 P positive regulation of actin filament polymerization
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0042803 F protein homodimerization activity
GO:0043406 P positive regulation of MAP kinase activity
GO:0046982 F protein heterodimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0051491 P positive regulation of filopodium assembly
GO:0090316 P positive regulation of intracellular protein transport
RNA-seq EntryA_SariMSG_c5840_g1_i1
Sequence
(Amino Acid)
ECHVVSDRAACSCLPGYHGAPPACRPECSVNSDCPTNRACIHLKCKDPCIHSCGLEARCQ
VVGHNPICTCPEHLSEGDPFIKCYRKSVMEPMPDPCLLSPCGPHSTCRNEAGRAVCACEP
GTLGAPPACRPQCVINQDCPLALACLTGTCVNPCVGSCGFNARCNVQNHQPICSCDIGYS
GDPFAGCALIETPKEVLHHACNPSPCGPNAICKERNGAGSCTCVNDFYGDPYHGCRPE
(78 a.a.)

- SilkBase 1999-2023 -