SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG11254_internal:A_SariMSG_c24464_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		hypothetical_protein_KGM_210639_[Danaus_plexippus_plexippus]
Ontology
GO:0002083 F 4-hydroxybenzoate decaprenyltransferase activity
GO:0003899 F DNA-directed 5'-3' RNA polymerase activity
GO:0004659 F prenyltransferase activity
GO:0005666 C RNA polymerase III complex
GO:0005736 C RNA polymerase I complex
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0006360 P transcription by RNA polymerase I
GO:0006744 P ubiquinone biosynthetic process
GO:0008299 P isoprenoid biosynthetic process
GO:0008340 P determination of adult lifespan
GO:0008412 F 4-hydroxybenzoate octaprenyltransferase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0047293 F 4-hydroxybenzoate nonaprenyltransferase activity
GO:0048009 P insulin-like growth factor receptor signaling pathway
GO:0050829 P defense response to Gram-negative bacterium
GO:0050830 P defense response to Gram-positive bacterium
GO:0050832 P defense response to fungus
RNA-seq EntryA_SariMSG_c24464_g1_i1
Sequence
(Amino Acid)
LVLFLSGTTRPLHNLPDSKLSILFLSFFIFRQDKLDDARIGIKSTALTFGSRTRSALSAT
LALSVAGLAYAGANAGLGHAYTAALLAYGARTGYQIYTLNTEDPNDCAAKFKSNSLIGLL
IFLGIITGGYTTYNQNRGDRK
(46 a.a.)

- SilkBase 1999-2023 -