SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11250_3prime_partial:A_SariMSG_c24461_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
helicase_domino_[Bombyx_mori]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000166 F nucleotide binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0002165 P instar larval or pupal development
GO:0003677 F DNA binding
GO:0004386 F helicase activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006325 P chromatin organization
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008283 P cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0016458 P obsolete gene silencing
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016787 F hydrolase activity
GO:0019233 P sensory perception of pain
GO:0022008 P neurogenesis
GO:0030097 P hemopoiesis
GO:0030154 P cell differentiation
GO:0035019 P somatic stem cell population maintenance
GO:0035207 P negative regulation of hemocyte proliferation
GO:0035222 P wing disc pattern formation
GO:0035267 C NuA4 histone acetyltransferase complex
GO:0036098 P male germ-line stem cell population maintenance
GO:0043486 P histone exchange
GO:0045747 P positive regulation of Notch signaling pathway
GO:0048477 P oogenesis
GO:0048813 P dendrite morphogenesis
GO:0070983 P dendrite guidance
GO:2000637 P positive regulation of gene silencing by miRNA
RNA-seq EntryA_SariMSG_c24461_g1_i1
Sequence
(Amino Acid)
MSGRDEFATSSGLCFGGAPLLMGVERSGGACGRAFNGGSGAGCAAESGELEGRQGQGAPV
GVNEEPPRKRARTARPEDAAALRCAVLDCHLLRLKMLRDRFTEQLSELYFLQAGGNMMDY
GTWRRRPPAPQLAAFIDARRPALAPELPPAPAA
(50 a.a.)

- SilkBase 1999-2023 -