SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11221_5prime_partial:A_SariMSG_c24435_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protein_4.1_homolog_isoform_X2_[Amyelois_transitella]
Ontology
GO:0003015 P heart process
GO:0003674 F molecular_function
GO:0003779 F actin binding
GO:0005198 F structural molecule activity
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0005920 C smooth septate junction
GO:0006612 P protein targeting to membrane
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0007391 P dorsal closure
GO:0007435 P salivary gland morphogenesis
GO:0007527 P adult somatic muscle development
GO:0008092 F cytoskeletal protein binding
GO:0008362 P chitin-based embryonic cuticle biosynthetic process
GO:0009790 P embryo development
GO:0019991 P septate junction assembly
GO:0030054 C cell junction
GO:0035151 P regulation of tube size, open tracheal system
GO:0035321 P maintenance of imaginal disc-derived wing hair orientation
GO:0045169 C fusome
GO:0045170 C spectrosome
GO:0045216 P cell-cell junction organization
GO:0060857 P establishment of glial blood-brain barrier
GO:0061343 P cell adhesion involved in heart morphogenesis
RNA-seq EntryA_SariMSG_c24435_g1_i2
Sequence
(Amino Acid)
QRDSGIPIDFEEAAEGHYYVTEPGSYSTTTTSTVMGNAPFGSMVYGATARTSTGAQASAA
EEVLGADESEVVSSQTISSKTRTVETITYKTERNGVIETRVEQKITIQSDGDPIDHDRAL
AEAIQEATAMNPDMTVEKIEIQQQSTQP
*(48 a.a.)

- SilkBase 1999-2023 -