SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG11173_internal:A_SariMSG_c24404_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		protein-O-fucosyltransferase_1_isoform_X1_[Bombyx_mori]
Ontology
GO:0005112 F Notch binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005975 P carbohydrate metabolic process
GO:0006004 P fucose metabolic process
GO:0006355 P regulation of transcription, DNA-templated
GO:0006486 P protein glycosylation
GO:0006493 P protein O-linked glycosylation
GO:0006897 P endocytosis
GO:0007219 P Notch signaling pathway
GO:0007399 P nervous system development
GO:0008417 F fucosyltransferase activity
GO:0008593 P regulation of Notch signaling pathway
GO:0009790 P embryo development
GO:0016266 P O-glycan processing
GO:0016337 P cell-cell adhesion
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0030163 P protein catabolic process
GO:0031410 C cytoplasmic vesicle
GO:0036065 P fucosylation
GO:0036066 P protein O-linked fucosylation
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045747 P positive regulation of Notch signaling pathway
GO:0046331 P lateral inhibition
GO:0046922 F peptide-O-fucosyltransferase activity
RNA-seq EntryA_SariMSG_c24404_g1_i2
Sequence
(Amino Acid)
VLFRSVKACQHVQDSPILFAAPQCVGYKNERGPLTPSMCLPQPSEVIKQIKRALKKLDGV
KYIFVASDSKHMIEELSYSLRSWEIKVIRLQPANPHLDLAILAQANYFIGNCVSSYTAFV
KRERDVKGLPSEFWSYPSQIG
(46 a.a.)

- SilkBase 1999-2023 -