SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG11145_internal:A_SariMSG_c24388_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_probable_ATP-dependent_RNA_helicase_DDX20_isoform_X3_[Papilio_polytes]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0000387 P spliceosomal snRNP assembly
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006397 P mRNA processing
GO:0008285 P negative regulation of cell population proliferation
GO:0008380 P RNA splicing
GO:0010501 P RNA secondary structure unwinding
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0017053 C transcription repressor complex
GO:0019904 F protein domain specific binding
GO:0030674 F protein-macromolecule adaptor activity
GO:0032797 C SMN complex
GO:0034719 C SMN-Sm protein complex
GO:0042826 F histone deacetylase binding
GO:0043065 P positive regulation of apoptotic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048477 P oogenesis
GO:0050810 P regulation of steroid biosynthetic process
GO:0070491 F DNA-binding transcription factor binding
GO:0090571 C RNA polymerase II transcription repressor complex
GO:0097504 C Gemini of coiled bodies
RNA-seq EntryA_SariMSG_c24388_g1_i1
Sequence
(Amino Acid)
NMAIQLEQRTQDVKISEDITFETMLLNKRTLKGLRNIGFYRPSPIQLHGIPLGKCGFDLL
LEAKSGTGKTAVFTIITLEKLDLNKGLQAIILAPTREIAAQVCDVIKQIGSKYEGLIVEV
VMGGLPLQDDIEKLKNHVHIIVGSPGRLKHLIQDNHIDVSSVKILVLDECDKLMDKSFLP
DVNYIFSELPNQKQVIMSSATYPENCITFINKYVNSAQHICQIG
(73 a.a.)

- SilkBase 1999-2023 -