SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1110_5prime_partial:A_SariMSG_c5723_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		putative_phosphatidate_phosphatase_isoform_X2_[Bombyx_mori]
Ontology
GO:0005887 C integral component of plasma membrane
GO:0005918 C septate junction
GO:0006644 P phospholipid metabolic process
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007424 P open tracheal system development
GO:0008195 F phosphatidate phosphatase activity
GO:0008354 P germ cell migration
GO:0009880 P embryonic pattern specification
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0019991 P septate junction assembly
GO:0035233 P germ cell repulsion
GO:0035234 P ectopic germ cell programmed cell death
GO:0042577 F lipid phosphatase activity
GO:0042803 F protein homodimerization activity
GO:0045177 C apical part of cell
GO:0045824 P negative regulation of innate immune response
GO:0046839 P phospholipid dephosphorylation
GO:0050829 P defense response to Gram-negative bacterium
RNA-seq EntryA_SariMSG_c5723_g1_i1
Sequence
(Amino Acid)
FSAYTMLYFAMYLQKRFTWRGSKLLRHGIQFLLMLFAWYTVMSRVSDYKHHWSDVLAGYT
IGTLYAVIIFAFASNLRKTPRSGRTYGHHDAEMHTTNGNSHPRVQV
*(34 a.a.)

- SilkBase 1999-2023 -