SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG110_complete:A_SariMSG_c411_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		glycogen_synthase_kinase-3_beta_isoform_X5_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003382 P epithelial cell morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005938 C cell cortex
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007051 P spindle organization
GO:0007143 P female meiotic nuclear division
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007350 P blastoderm segmentation
GO:0007367 P segment polarity determination
GO:0007423 P sensory organ development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007507 P heart development
GO:0007622 P rhythmic behavior
GO:0007623 P circadian rhythm
GO:0008355 P olfactory learning
GO:0008407 P chaeta morphogenesis
GO:0009649 P entrainment of circadian clock
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030054 C cell junction
GO:0030162 P regulation of proteolysis
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030424 C axon
GO:0030589 P pseudocleavage involved in syncytial blastoderm formation
GO:0030707 P ovarian follicle cell development
GO:0031594 C neuromuscular junction
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035019 P somatic stem cell population maintenance
GO:0035293 P chitin-based larval cuticle pattern formation
GO:0035309 P wing and notum subfield formation
GO:0035324 C female germline ring canal
GO:0042306 P regulation of protein import into nucleus
GO:0042752 P regulation of circadian rhythm
GO:0042995 C cell projection
GO:0043508 P negative regulation of JUN kinase activity
GO:0045169 C fusome
GO:0045202 C synapse
GO:0045475 P locomotor rhythm
GO:0045610 P regulation of hemocyte differentiation
GO:0045732 P positive regulation of protein catabolic process
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046959 P habituation
GO:0048477 P oogenesis
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051321 P meiotic cell cycle
GO:0070507 P regulation of microtubule cytoskeleton organization
GO:0070884 P regulation of calcineurin-NFAT signaling cascade
GO:0072347 P response to anesthetic
GO:0072686 C mitotic spindle
GO:0090163 P establishment of epithelial cell planar polarity
RNA-seq EntryA_SariMSG_c411_g1_i1
Sequence
(Amino Acid)
MSGRPRTTSFAEGSKSVRKTFDNQTPKPPLGGVKISSKDGSKVTTVVATPGQGPDRPQEV
SYADMKLIGNGSFGVVYQAKLCDTGELIAIKKVLQDKRFKNRELQIMRRLEHCNIVKLKY
FFYSSGEKKDEVYLNLVLEYIPETVYKVARHYSKDEQTIPISFIKLYMYQLFRSLAYIHS
LGICHRDIKPQNLLLDPKTGVLKLCDFGSAKHLIHGEPNVSYICSRYYRAPELIFGAVNY
TTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTRDQIREMNPNYTEFKFP
QIKSHPWAKVFRACTPPDAIALVSRLLEYTPGARLSPMQACAHSFFDELREPTARLPNGR
PLPPLFNFTDYELNIQPSLNEFLKQRTGAAAGAEAAGGSATPAEHAPDAAGTVPAEGVAR
*(139 a.a.)

- SilkBase 1999-2023 -