SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1105_internal:A_SariMSG_c5711_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Phospholipase_D1,_partial_[Operophtera_brumata]
Ontology
GO:0000139 C Golgi membrane
GO:0003824 F catalytic activity
GO:0004630 F phospholipase D activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006629 P lipid metabolic process
GO:0006654 P phosphatidic acid biosynthetic process
GO:0008654 P phospholipid biosynthetic process
GO:0009395 P phospholipid catabolic process
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0016787 F hydrolase activity
GO:0030027 C lamellipodium
GO:0030334 P regulation of cell migration
GO:0030335 P positive regulation of cell migration
GO:0031902 C late endosome membrane
GO:0031982 C vesicle
GO:0031985 C Golgi cisterna
GO:0032534 P regulation of microvillus assembly
GO:0035091 F phosphatidylinositol binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043434 P response to peptide hormone
GO:0048017 P inositol lipid-mediated signaling
GO:0048471 C perinuclear region of cytoplasm
GO:0050764 P regulation of phagocytosis
GO:0070290 F N-acylphosphatidylethanolamine-specific phospholipase D activity
RNA-seq EntryA_SariMSG_c5711_g1_i1
Sequence
(Amino Acid)
HAPPVKFNSIHRKVFIPGVEIKVRFVENERSVTTHLLNANLYSISLQHGSFTWTVKKRYK
HILYLHQQLTLYRASLNIPFPTKTHKSRRASFKNTVVTEEKAERVALQAIPRSNSKKREG
RPRKRKGALPRFPKKPEVMITYEGIQLRMKQLEEYLYNLLNISIYRNHHETVKFLEVSNV
SFISELGNKGKEGMIQKRTGRSEER
(67 a.a.)

- SilkBase 1999-2023 -