SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG1092_3prime_partial:A_SariMSG_c5611_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_mitotic_spindle_assembly_checkpoint_protein_MAD2B_[Plutella_xylostella]
Ontology
GO:0001558 P regulation of cell growth
GO:0005634 C nucleus
GO:0005680 C anaphase-promoting complex
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006302 P double-strand break repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008432 F JUN kinase binding
GO:0016035 C zeta DNA polymerase complex
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0042177 P negative regulation of protein catabolic process
GO:0042772 P DNA damage response, signal transduction resulting in transcription
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0051301 P cell division
GO:0060564 P negative regulation of ubiquitin protein ligase activity
RNA-seq EntryA_SariMSG_c5611_g1_i1
Sequence
(Amino Acid)
MDACFIDITLEFQAVAFHSILYNSSVYPQSIFEAKKKYNLVVYQSMHPEVNEYINLCLKT
ISECLKNDQLNRVVLAVTDDCYKPVIKFVFNFDKNCCFDDTSDAYLVQCEQNLR
(37 a.a.)

- SilkBase 1999-2023 -