SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG10852_5prime_partial:A_SariMSG_c24230_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
patj_homolog_[Helicoverpa_armigera]
Ontology
GO:0001736 P establishment of planar polarity
GO:0002009 P morphogenesis of an epithelium
GO:0005080 F protein kinase C binding
GO:0005515 F protein binding
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005875 C microtubule associated complex
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005918 C septate junction
GO:0007043 P cell-cell junction assembly
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0008594 P photoreceptor cell morphogenesis
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016333 P morphogenesis of follicular epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0032033 F myosin II light chain binding
GO:0034332 P adherens junction organization
GO:0034334 P adherens junction maintenance
GO:0035003 C subapical complex
GO:0035088 P establishment or maintenance of apical/basal cell polarity
GO:0035209 P pupal development
GO:0035509 P negative regulation of myosin-light-chain-phosphatase activity
GO:0045176 P apical protein localization
GO:0045179 C apical cortex
GO:0045186 P zonula adherens assembly
GO:0045196 P establishment or maintenance of neuroblast polarity
GO:0045494 P photoreceptor cell maintenance
RNA-seq EntryA_SariMSG_c24230_g2_i2
Sequence
(Amino Acid)
SLAGAGTGESGSLSAGGKVRSRSLEPLTGLAMWSSEPQIIELVKGERGLGFSILDYQDPL
RPSHTLVVIRSLVPGGVAQQDGRLIPGDRLLFVNDQNLEDASLEQAVAALKGAPRGVVRI
GVAKPLPLADAPPPLPQTAPPTAN
*(47 a.a.)

- SilkBase 1999-2023 -