SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG10847_3prime_partial:A_SariMSG_c24226_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
kelch-like_ECH-associated_protein_1_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0001887 P selenium compound metabolic process
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005884 C actin filament
GO:0005913 C adherens junction
GO:0005925 C focal adhesion
GO:0006108 P malate metabolic process
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008134 F transcription factor binding
GO:0009812 P flavonoid metabolic process
GO:0010038 P response to metal ion
GO:0010499 P proteasomal ubiquitin-independent protein catabolic process
GO:0010629 P negative regulation of gene expression
GO:0016567 P protein ubiquitination
GO:0019694 P alkanesulfonate metabolic process
GO:0030496 C midbody
GO:0031463 C Cul3-RING ubiquitin ligase complex
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035902 P response to immobilization stress
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042994 P cytoplasmic sequestering of transcription factor
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045604 P regulation of epidermal cell differentiation
GO:0051259 P protein complex oligomerization
GO:0071353 P cellular response to interleukin-4
GO:0071407 P cellular response to organic cyclic compound
GO:0097066 P response to thyroid hormone
RNA-seq EntryA_SariMSG_c24226_g1_i2
Sequence
(Amino Acid)
MDTDDDAVHDNMLDDMPPINCDTTLEGAVGTGSNDIGDMTFCMGNYISDFMKMMFTMRSH
HMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQGVCPSAMAWLVY
FMYTGKIRITEVTVCQLLPAATMFQISNVIDACCAFLERQLDPSNAIGIANFAEQHGCVD
LKKKANQFIERHFTQVCQEEEFLQLTKQELINLIRKDELNVREEREVYNAVLSWVKYDED
RRHPRMENILQAVRCQYLTPSFLKEQMSTCTVLKKVPACREYLAKIFKDLTLHKKPVRSE
ERR
(100 a.a.)

- SilkBase 1999-2023 -