SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10770_internal:A_SariMSG_c24182_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		mkk7_[Danaus_plexippus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708 F MAP kinase kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006970 P response to osmotic stress
GO:0007165 P signal transduction
GO:0007254 P JNK cascade
GO:0007257 P obsolete activation of JUN kinase activity
GO:0008022 F protein C-terminus binding
GO:0008545 F JUN kinase kinase activity
GO:0009408 P response to heat
GO:0009411 P response to UV
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0031435 F mitogen-activated protein kinase kinase kinase binding
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0034612 P response to tumor necrosis factor
GO:0035897 P obsolete proteolysis in other organism
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0043525 P positive regulation of neuron apoptotic process
GO:0046872 F metal ion binding
GO:0051403 P stress-activated MAPK cascade
GO:0051973 P positive regulation of telomerase activity
GO:0072709 P cellular response to sorbitol
GO:1904355 P positive regulation of telomere capping
RNA-seq EntryA_SariMSG_c24182_g1_i2
Sequence
(Amino Acid)
PPQLPDDTEFTSEFKSFVSQCLTKNYRQRPKYVKLLEHPFVMKSARSSVSVGAWYASLPL
LGPAPAVPPGRAPKPGKGDGAETPPTPQPVRNFVTSSQHWMPEQVTPTPSRAWWANHGSE
NAGGSSSQPASLEADFSQHSPYPRRRTIDACASPPPPPVRRVSADNRWRASPASSGNTSP
IVLQRFYHQNQQRRSRVDLHSTPRHRSLSREHSAGRSPEPPPRMSRQHQMLG
(76 a.a.)

- SilkBase 1999-2023 -