SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10652_internal:A_SariMSG_c24101_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		prostaglandin_E_synthase_2_[Danaus_plexippus_plexippus]
Ontology
GO:0000139 C Golgi membrane
GO:0001516 P prostaglandin biosynthetic process
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0006693 P prostaglandin metabolic process
GO:0009055 F electron transfer activity
GO:0015035 F protein-disulfide reductase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016853 F isomerase activity
GO:0020037 F heme binding
GO:0043295 F glutathione binding
GO:0045454 P cell redox homeostasis
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046903 P secretion
GO:0050220 F prostaglandin-E synthase activity
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_SariMSG_c24101_g1_i3
Sequence
(Amino Acid)
EIKMGSYGNKNGKITTEIANKYFVMHNKPYLNNNEKVAEAEERKWRQWADDVLVHVLSPN
VYRTPGEALETFRWFEEAGGWRQTFPTWECALMVYVGAAAMWIISKRLKARHQIEDARLS
LYGAAKEWMKAVEAKGTPFLGGDNPNL
(48 a.a.)

- SilkBase 1999-2023 -