SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10624_internal:A_SariMSG_c24082_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		fatty_acid_transport_protein,_partial_[Ascotis_selenaria_cretacea]
Ontology
GO:0000166 F nucleotide binding
GO:0001579 P medium-chain fatty acid transport
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006646 P phosphatidylethanolamine biosynthetic process
GO:0006654 P phosphatidic acid biosynthetic process
GO:0006655 P phosphatidylglycerol biosynthetic process
GO:0006656 P phosphatidylcholine biosynthetic process
GO:0006659 P phosphatidylserine biosynthetic process
GO:0006661 P phosphatidylinositol biosynthetic process
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0008152 P metabolic process
GO:0009409 P response to cold
GO:0012505 C endomembrane system
GO:0015245 F fatty acid transmembrane transporter activity
GO:0015908 P fatty acid transport
GO:0015909 P long-chain fatty acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0031410 C cytoplasmic vesicle
GO:0031652 P positive regulation of heat generation
GO:0031957 F very long-chain fatty acid-CoA ligase activity
GO:0032049 P cardiolipin biosynthetic process
GO:0032868 P response to insulin
GO:0033211 P adiponectin-activated signaling pathway
GO:0042803 F protein homodimerization activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0071072 P negative regulation of phospholipid biosynthetic process
GO:0071902 P positive regulation of protein serine/threonine kinase activity
RNA-seq EntryA_SariMSG_c24082_g1_i1
Sequence
(Amino Acid)
SRRIRPPSPKDQQHKVRTVYGNGMRPTIWPDFVKRFNIKRVVEFYGATEGNANIVNINNK
TGAIGFVSRIIPAVYPIAILKVDQETGEPIRNSKGLCQLAKPNEPGVFIGKIKPNNPSRA
FLGYVDKQASDKKIVRDVFEHGDSEIGRAS
(49 a.a.)

- SilkBase 1999-2023 -