SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10609_5prime_partial:A_SariMSG_c24072_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		ankyrin-3_isoform_X1_[Bombyx_mori]
Ontology
GO:0002027 P regulation of heart rate
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006874 P cellular calcium ion homeostasis
GO:0007165 P signal transduction
GO:0008093 F cytoskeletal anchor activity
GO:0008104 P protein localization
GO:0010628 P positive regulation of gene expression
GO:0010881 P regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0010882 P regulation of cardiac muscle contraction by calcium ion signaling
GO:0014704 C intercalated disc
GO:0015459 F potassium channel regulator activity
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0030018 C Z disc
GO:0030054 C cell junction
GO:0030315 C T-tubule
GO:0030507 F spectrin binding
GO:0030674 F protein-macromolecule adaptor activity
GO:0031430 C M band
GO:0031647 P regulation of protein stability
GO:0031672 C A band
GO:0033292 P T-tubule organization
GO:0034394 P protein localization to cell surface
GO:0034613 P cellular protein localization
GO:0036309 P protein localization to M-band
GO:0036371 P protein localization to T-tubule
GO:0042383 C sarcolemma
GO:0042981 P regulation of apoptotic process
GO:0043034 C costamere
GO:0043268 P positive regulation of potassium ion transport
GO:0044325 F transmembrane transporter binding
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0048471 C perinuclear region of cytoplasm
GO:0050821 P protein stabilization
GO:0051117 F ATPase binding
GO:0051924 P regulation of calcium ion transport
GO:0051928 P positive regulation of calcium ion transport
GO:0055117 P regulation of cardiac muscle contraction
GO:0060048 P cardiac muscle contraction
GO:0070972 P protein localization to endoplasmic reticulum
GO:0072659 P protein localization to plasma membrane
GO:0072661 P protein localization to plasma membrane
GO:0086004 P regulation of cardiac muscle cell contraction
GO:0086014 P atrial cardiac muscle cell action potential
GO:0086015 P SA node cell action potential
GO:0086036 P regulation of cardiac muscle cell membrane potential
GO:0086066 P atrial cardiac muscle cell to AV node cell communication
GO:0086070 P SA node cell to atrial cardiac muscle cell communication
GO:0086091 P regulation of heart rate by cardiac conduction
GO:0097481 C postsynaptic density
GO:0098904 P regulation of AV node cell action potential
GO:0098907 P regulation of SA node cell action potential
GO:0098910 P regulation of atrial cardiac muscle cell action potential
GO:1901018 P positive regulation of potassium ion transmembrane transporter activity
GO:1901019 P regulation of calcium ion transmembrane transporter activity
GO:1901021 P positive regulation of calcium ion transmembrane transporter activity
GO:2001257 P regulation of cation channel activity
GO:2001259 P positive regulation of cation channel activity
RNA-seq EntryA_SariMSG_c24072_g1_i3
Sequence
(Amino Acid)
CSSDLSDESRITSVKSLSPSSLTSSPQADLEWDEEIGNVAPSTSEDETWTSMYKWYAAIL
ESTGAAIASASAVSHGIDQQDTFMRTALHYAVEQGHFGIVKLLVDAGCKLDIPAGDGMTA
LHVAVVKNHIEIVRLLLVAGSNVNYKTHEKMTPLHFATSRGYLDLVRILLKNGAYLEARD
TNERTALYLAAGRGHTDVVKLLITNGANVNGEEIHGYTPLCEAVWQRYVSVVEILLASGA
RITHSHRLLHNAIIQRQEEIVKMLSNFGGGINLYNDNGDTPLLLAARSLHPTVARLLLQK
GANVNSCNCITGANALHIAVESADNAEHFEELLQCLSEYKIDMNGTALTGDTALNRALLL
QRDHAAVLLIRYGADVNTCDLHSCGLDNLSIASRRRTNFLARMLIKAGHYVTVPDINIPI
AKLSKTANWLYHASKQPLSLSDLCRIKIRLQCKNRILYKYVSSLLLPNSLKRFI
*(157 a.a.)

- SilkBase 1999-2023 -