SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG10560_internal:A_SariMSG_c24046_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_serine/threonine-protein_kinase_mTOR_[Papilio_polytes]
Ontology
GO:0000166 F nucleotide binding
GO:0001558 P regulation of cell growth
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007411 P axon guidance
GO:0007430 P terminal branching, open tracheal system
GO:0007520 P myoblast fusion
GO:0007525 P somatic muscle development
GO:0007584 P response to nutrient
GO:0008144 F obsolete drug binding
GO:0008340 P determination of adult lifespan
GO:0008406 P gonad development
GO:0009594 P detection of nutrient
GO:0016242 P negative regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0030307 P positive regulation of cell growth
GO:0031931 C TORC1 complex
GO:0031932 C TORC2 complex
GO:0032456 P endocytic recycling
GO:0035264 P multicellular organism growth
GO:0040007 P growth
GO:0040018 P positive regulation of multicellular organism growth
GO:0042331 P phototaxis
GO:0043621 F protein self-association
GO:0045176 P apical protein localization
GO:0045793 P positive regulation of cell size
GO:0046622 P positive regulation of organ growth
GO:0048142 P germarium-derived cystoblast division
GO:0048813 P dendrite morphogenesis
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0090070 P positive regulation of ribosome biogenesis
GO:2000331 P regulation of terminal button organization
GO:2000377 P regulation of reactive oxygen species metabolic process
GO:2001023 P regulation of response to drug
RNA-seq EntryA_SariMSG_c24046_g1_i2
Sequence
(Amino Acid)
PGTSSRVTRDKFPEKIPFRLTRMLINAMEVTGIEGTYRRTCESVMEVLHRHKDSVMAVLE
AFVYDPLLNWRLIDASRRSRGDLDPSACPGAPGTCPGPGPPGGAP
(34 a.a.)

- SilkBase 1999-2023 -