SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1053_internal:A_SariMSG_c5372_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		sialin_[Helicoverpa_armigera]
Ontology
GO:0005351 F carbohydrate:proton symporter activity
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006820 P anion transport
GO:0006865 P amino acid transport
GO:0015136 F sialic acid transmembrane transporter activity
GO:0015293 F symporter activity
GO:0015538 F sialic acid:proton symporter activity
GO:0015739 P sialic acid transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0030054 C cell junction
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0045202 C synapse
GO:0055085 P transmembrane transport
GO:1905039 P carboxylic acid transmembrane transport
RNA-seq EntryA_SariMSG_c5372_g1_i1
Sequence
(Amino Acid)
VSTMAKTEKSFPRNFTGCLTCVQVLNIMVLLGFMLNYALRVNLTIAIVEMIYDDKDNQTV
LTNFTLGSHNVTEHPGHIEQTRYHWDTKQKNLLLGCFFWGYVLTDRK
(34 a.a.)

- SilkBase 1999-2023 -