SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1051_internal:A_SariMSG_c5353_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Plexin-B_[Operophtera_brumata]
Ontology
GO:0002116 C semaphorin receptor complex
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0008045 P motor neuron axon guidance
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017154 F semaphorin receptor activity
GO:0030154 P cell differentiation
GO:0030334 P regulation of cell migration
GO:0035021 P negative regulation of Rac protein signal transduction
GO:0035025 P positive regulation of Rho protein signal transduction
GO:0048841 P regulation of axon extension involved in axon guidance
GO:0071526 P semaphorin-plexin signaling pathway
GO:0071678 P olfactory bulb axon guidance
GO:0097374 P sensory neuron axon guidance
GO:1902287 P semaphorin-plexin signaling pathway involved in axon guidance
RNA-seq EntryA_SariMSG_c5353_g1_i1
Sequence
(Amino Acid)
LSLISRQNDSFNTPYKIPCKNCTGIYCSNTHIRVYNSDITDQNVHYYHLVKPIEYQHIVN
KSSEHSHKAIPEIFLTRLLSTKGTVHKFVDDFFSTILTVNE
(32 a.a.)

- SilkBase 1999-2023 -