SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10512_internal:A_SariMSG_c24017_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		glypican-4_[Bombyx_mori]
Ontology
GO:0005507 F copper ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0008150 P biological_process
GO:0014037 P Schwann cell differentiation
GO:0016020 C membrane
GO:0017134 F fibroblast growth factor binding
GO:0030200 P heparan sulfate proteoglycan catabolic process
GO:0031225 C anchored component of membrane
GO:0032288 P myelin assembly
GO:0040037 P negative regulation of fibroblast growth factor receptor signaling pathway
GO:0043025 C neuronal cell body
GO:0043236 F laminin binding
GO:0043395 F heparan sulfate proteoglycan binding
GO:0045121 C membrane raft
GO:0070052 F collagen V binding
GO:2001016 P positive regulation of skeletal muscle cell differentiation
RNA-seq EntryA_SariMSG_c24017_g1_i2
Sequence
(Amino Acid)
RVLFRSPAAAGGMDIDFKSYEFDKKGQKKKKPSAKNDDSHGSEWGGPALEKLVRETRTRI
RSSRHYWNHLPALLCNSASIPNSPCFNGTEVASYTLNAAGEGTAGLASNPEVRGNVNPAA
TTIAAGETETLKTLTARLKDAFNGVEVQWTDAQDRIDLPRS
(52 a.a.)

- SilkBase 1999-2023 -