SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10472_internal:A_SariMSG_c23997_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		DNA_excision_repair_protein_ERCC-6-like_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0000303 P response to superoxide
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0003682 F chromatin binding
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006284 P base-excision repair
GO:0006290 P pyrimidine dimer repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006362 P transcription elongation from RNA polymerase I promoter
GO:0006366 P transcription by RNA polymerase II
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0007256 P obsolete activation of JNKK activity
GO:0007257 P obsolete activation of JUN kinase activity
GO:0008022 F protein C-terminus binding
GO:0008023 C transcription elongation factor complex
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411 P response to UV
GO:0009636 P response to toxic substance
GO:0010165 P response to X-ray
GO:0010224 P response to UV-B
GO:0010332 P response to gamma radiation
GO:0016787 F hydrolase activity
GO:0030296 F protein tyrosine kinase activator activity
GO:0032403 F protein-containing complex binding
GO:0032784 P regulation of DNA-templated transcription, elongation
GO:0032786 P positive regulation of DNA-templated transcription, elongation
GO:0035264 P multicellular organism growth
GO:0045494 P photoreceptor cell maintenance
GO:0045815 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0047485 F protein N-terminus binding
GO:0061098 P positive regulation of protein tyrosine kinase activity
RNA-seq EntryA_SariMSG_c23997_g1_i1
Sequence
(Amino Acid)
QRDLYMGYLMSGTVRSVLDKDNKYGDPLRARILVALSTLRKICNHPDLYLYEAQEDYEQI
NVDNFGDWKRSGKMTVVNSLLKIWHKQGHRALIFSQSRAMLCLLEQYLQNQQYKYLKMDG
SVNVGQRQNIIKTFNENPEYIVFLATTRVGGLGVNLTGADRVIIYDPDWNPATDDQAKER
AWRIGQERNVTVYRLLSAGTIEEKIYQRQIFKHILSNKILIDPHQKNLLTTSTLQGLFTF
EEPNHEGDTETASLFKHTKVNVGKNRKYKNSGTQSNTGGALSKHKLEAMRKMAKEISKKI
SSNEVKHKEDSIVRNCREEYKKKRELLLNPPKSEEPEVNLVDDEVTNIPFDAILSELDIV
NMHVKKNYEQNLIKEALTSQVKDDQENRTNVEMETKEQSNSSSIDTSTNNIFKDLKKDPS
SENDFSSKDNMEHKHLKRRHSSVSEYEVENLVAIKKVKKKKKQKKEKNTEQIGR
(157 a.a.)

- SilkBase 1999-2023 -