SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10440_5prime_partial:A_SariMSG_c23974_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		chromatin-remodeling_complex_ATPase_chain_Iswi_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0000733 P obsolete DNA strand renaturation
GO:0000790 C chromatin
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007420 P brain development
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0016568 P chromatin organization
GO:0016589 C NURF complex
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016887 F ATP hydrolysis activity
GO:0030182 P neuron differentiation
GO:0031491 F nucleosome binding
GO:0036310 F ATP-dependent DNA/DNA annealing activity
GO:0043044 P chromatin remodeling
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0070615 F ATP-dependent chromatin remodeler activity
GO:0090537 C CERF complex
GO:2000177 P regulation of neural precursor cell proliferation
RNA-seq EntryA_SariMSG_c23974_g1_i1
Sequence
(Amino Acid)
EEEDRFLVCMLHKLGFDKENVYEELRASVHAAPQFRFDWFLKSRTAVELQRRCNTLITLI
ERENQELEEKERAEKKKKSGNANQNTPGNNVTGKGTRGEEEEKRQRESEHARE
*(37 a.a.)

- SilkBase 1999-2023 -