SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10426_3prime_partial:A_SariMSG_c23957_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		protein_phosphatase_1_regulatory_subunit_12C_isoform_X13_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000776 C kinetochore
GO:0004721 F phosphoprotein phosphatase activity
GO:0004857 F enzyme inhibitor activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005925 C focal adhesion
GO:0006470 P protein dephosphorylation
GO:0007067 P mitotic cell cycle
GO:0007165 P signal transduction
GO:0015629 C actin cytoskeleton
GO:0019208 F phosphatase regulator activity
GO:0019901 F protein kinase binding
GO:0030018 C Z disc
GO:0030155 P regulation of cell adhesion
GO:0031672 C A band
GO:0035507 P regulation of myosin-light-chain-phosphatase activity
GO:0035508 P positive regulation of myosin-light-chain-phosphatase activity
GO:0035690 P cellular response to xenobiotic stimulus
GO:0043086 P negative regulation of catalytic activity
GO:0043292 C contractile fiber
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046822 P regulation of nucleocytoplasmic transport
GO:0051297 P centrosome cycle
GO:0071889 F 14-3-3 protein binding
GO:0072357 C PTW/PP1 phosphatase complex
GO:1903140 P regulation of establishment of endothelial barrier
RNA-seq EntryA_SariMSG_c23957_g1_i2
Sequence
(Amino Acid)
MTDNRSSSALFKRAEQLKRWEESDTNKQSPMPRGASQIQFSREIVFLAACTSGDKDEVQR
LLKMGADINTANVDGLTALHQACIDDNLDMVEFLVSNGADVNREIGRAS
(35 a.a.)

- SilkBase 1999-2023 -