SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10410_3prime_partial:A_SariMSG_c23939_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		syntaxin-17_isoform_X1_[Bombyx_mori]
Ontology
GO:0000149 F SNARE binding
GO:0000421 C autophagosome membrane
GO:0005484 F SNAP receptor activity
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005793 C endoplasmic reticulum-Golgi intermediate compartment
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006906 P vesicle fusion
GO:0006914 P autophagy
GO:0007030 P Golgi organization
GO:0012505 C endomembrane system
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0019903 F protein phosphatase binding
GO:0030134 C COPII-coated ER to Golgi transport vesicle
GO:0030868 C smooth endoplasmic reticulum membrane
GO:0030897 C HOPS complex
GO:0031201 C SNARE complex
GO:0031410 C cytoplasmic vesicle
GO:0033116 C endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0034497 P protein localization to phagophore assembly site
GO:0044233 C mitochondria-associated endoplasmic reticulum membrane
GO:0048278 P vesicle docking
GO:0097111 P endoplasmic reticulum-Golgi intermediate compartment organization
GO:0097352 P autophagosome maturation
RNA-seq EntryA_SariMSG_c23939_g1_i2
Sequence
(Amino Acid)
MEETNKLPLKRVELSLTKFNEVAIPHHLDLLRQHKANIIKYKEKDDYTKVRMEQTNARRV
ASQLRTLLGELEALRRQVRVDDWPKFDKLTQRSRDQTLRAIMDYLETSPLSINRRPVEQT
VAGSTMSTDSVGILAHNDELQDSESPLIQLQVNEQEVSINEREAML
(54 a.a.)

- SilkBase 1999-2023 -