SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1040_internal:A_SariMSG_c5248_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		protein_CBFA2T3_[Helicoverpa_armigera]
Ontology
GO:0000139 C Golgi membrane
GO:0001666 P response to hypoxia
GO:0003700 F DNA-binding transcription factor activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005794 C Golgi apparatus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0016020 C membrane
GO:0030154 P cell differentiation
GO:0030851 P granulocyte differentiation
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0045820 P negative regulation of glycolytic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:1903715 P regulation of aerobic respiration
RNA-seq EntryA_SariMSG_c5248_g1_i2
Sequence
(Amino Acid)
VEPTESTDIKRAANEIMATAVRQTEERVAEVRRRAEDAANQCCWNCGRKAQETCSGCNAA
RYCGAFCQHKDWENHHQVCSGRDQKPTAMLRTSPPITQTTLAKTLTRSNTPITASSTTPA
DNRLSLTTLNSA
(43 a.a.)

- SilkBase 1999-2023 -