SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10343_complete:A_SariMSG_c23889_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		extramacrochaetae_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001191 F obsolete transcriptional repressor activity, RNA polymerase II transcription factor binding
GO:0001964 P startle response
GO:0002121 P inter-male aggressive behavior
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007286 P spermatid development
GO:0007391 P dorsal closure
GO:0007422 P peripheral nervous system development
GO:0007458 P progression of morphogenetic furrow involved in compound eye morphogenesis
GO:0007460 P R8 cell fate commitment
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007494 P midgut development
GO:0007530 P sex determination
GO:0007541 P sex determination, primary response to X:A ratio
GO:0008258 P head involution
GO:0008283 P cell population proliferation
GO:0008407 P chaeta morphogenesis
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0030381 P chorion-containing eggshell pattern formation
GO:0031987 P locomotion involved in locomotory behavior
GO:0042675 P compound eye cone cell differentiation
GO:0043392 P negative regulation of DNA binding
GO:0045466 P R7 cell differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046331 P lateral inhibition
GO:0046552 P photoreceptor cell fate commitment
GO:0046843 P dorsal appendage formation
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048056 P R3/R4 cell differentiation
GO:0048854 P brain morphogenesis
RNA-seq EntryA_SariMSG_c23889_g1_i2
Sequence
(Amino Acid)
MKAITAVCATGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQ
HVIDYICDLQSALENHPAVGQFDAEGALASFPCAASPQPRPQRRPLGPRSAPNTILPTSP
LNQDHRNQTTPEKQNQPDRPTSC
*(47 a.a.)

- SilkBase 1999-2023 -