SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1033_complete:A_SariMSG_c5206_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		peroxiredoxin_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0001016 F RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0004601 F peroxidase activity
GO:0005102 F signaling receptor binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005777 C peroxisome
GO:0005782 C peroxisomal matrix
GO:0005829 C cytosol
GO:0006915 P apoptotic process
GO:0006954 P inflammatory response
GO:0006979 P response to oxidative stress
GO:0008379 F thioredoxin peroxidase activity
GO:0016209 F antioxidant activity
GO:0016480 P negative regulation of transcription by RNA polymerase III
GO:0016491 F oxidoreductase activity
GO:0031410 C cytoplasmic vesicle
GO:0032967 P positive regulation of collagen biosynthetic process
GO:0034614 P cellular response to reactive oxygen species
GO:0042744 P hydrogen peroxide catabolic process
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0046983 F protein dimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0051354 P negative regulation of oxidoreductase activity
GO:0051920 F peroxiredoxin activity
GO:0055114 P obsolete oxidation-reduction process
GO:0060785 P regulation of apoptosis involved in tissue homeostasis
GO:0070062 C extracellular exosome
GO:0070995 P NADPH oxidation
GO:0072541 F peroxynitrite reductase activity
GO:0098869 P cellular oxidant detoxification
GO:2001057 P reactive nitrogen species metabolic process
RNA-seq EntryA_SariMSG_c5206_g1_i1
Sequence
(Amino Acid)
MLFTSISIVRGISTFNNGVYVRALHTSKIAMAPIKVGDMLPSLDLFEDSPANKVNTCEIT
AGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHN
TKGKVRMLADPNGAFIKALDLGTNLPPLGGFRSKRFSMVINDSKVEELNVEPDGTGLSCS
LADKLKIKK
*(62 a.a.)

- SilkBase 1999-2023 -