SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10329_internal:A_SariMSG_c23882_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		V-type_proton_ATPase_116_kDa_subunit_a_[Bombyx_mori]
Ontology
GO:0000220 C vacuolar proton-transporting V-type ATPase, V0 domain
GO:0001503 P ossification
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005903 C brush border
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006885 P regulation of pH
GO:0007035 P vacuolar acidification
GO:0007588 P excretion
GO:0007605 P sensory perception of sound
GO:0008553 F P-type proton-exporting transporter activity
GO:0015078 F proton transmembrane transporter activity
GO:0015986 P ATP synthesis coupled proton transport
GO:0015991 P proton transmembrane transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016471 C vacuolar proton-transporting V-type ATPase complex
GO:0031526 C brush border membrane
GO:0033179 C proton-transporting V-type ATPase, V0 domain
GO:0045177 C apical part of cell
GO:0046961 F proton-transporting ATPase activity, rotational mechanism
GO:0051117 F ATPase binding
GO:0070062 C extracellular exosome
GO:0070072 P vacuolar proton-transporting V-type ATPase complex assembly
RNA-seq EntryA_SariMSG_c23882_g2_i1
Sequence
(Amino Acid)
WNIFFAGRYIILLMGCFSMYTGLVYNDIFSKSLNIFGTSWTIPYDNDTLEGHAALTLDPK
VAYTEVPYFIGIDPIWQSADNKIIFLNSYKMKLSIIFGVIHMIFGVCMSVVNYNFFK
(38 a.a.)

- SilkBase 1999-2023 -