SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG102_internal:A_SariMSG_c393_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_anaphase-promoting_complex_subunit_4_[Papilio_xuthus]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005680 C anaphase-promoting complex
GO:0005829 C cytosol
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0016567 P protein ubiquitination
GO:0019903 F protein phosphatase binding
GO:0030071 P regulation of mitotic metaphase/anaphase transition
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051301 P cell division
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051439 P obsolete regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0070979 P protein K11-linked ubiquitination
RNA-seq EntryA_SariMSG_c393_g1_i1
Sequence
(Amino Acid)
FDLQFYSSDYLSVIINHPYNNESSMFIQVPLKILLENSVEFNVKSKSCLFLESTSKIDIA
PLLQQGVYKTLDKIDGCRLAVSGGRKVAIVLSKSLRKVRIFEMEVDGEDEEDETLDTT
(38 a.a.)

- SilkBase 1999-2023 -