SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1025_internal:A_SariMSG_c5165_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		Extracellular_sulfatase_SULF-1-like_[Papilio_xuthus]
Ontology
GO:0003824 F catalytic activity
GO:0005615 C extracellular space
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0007389 P pattern specification process
GO:0008045 P motor neuron axon guidance
GO:0008152 P metabolic process
GO:0008449 F N-acetylglucosamine-6-sulfatase activity
GO:0008484 F sulfuric ester hydrolase activity
GO:0009986 C cell surface
GO:0016201 P synaptic target inhibition
GO:0016787 F hydrolase activity
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030202 P heparin metabolic process
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045880 P positive regulation of smoothened signaling pathway
GO:0046872 F metal ion binding
RNA-seq EntryA_SariMSG_c5165_g1_i2
Sequence
(Amino Acid)
VLFRSERAHPLPLRENTTRSKLKVQNKWQNNGYIPYPQQRERKPNIILILTDDQDVELGS
LNFMPRTMKAIRSAGAEFRHAYTTTPMCCPSRSSLLTGVYVHNHNVYTNNDNCSSPMWQA
THETNTFATYLSNA
(43 a.a.)

- SilkBase 1999-2023 -