SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10223_internal:A_SariMSG_c23807_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		spastin-like_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007079 P mitotic chromosome movement towards spindle pole
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008344 P adult locomotory behavior
GO:0008568 F microtubule-severing ATPase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0030154 P cell differentiation
GO:0031117 P positive regulation of microtubule depolymerization
GO:0034214 P protein hexamerization
GO:0050803 P regulation of synapse structure or activity
GO:0051013 P microtubule severing
GO:0051301 P cell division
RNA-seq EntryA_SariMSG_c23807_g1_i3
Sequence
(Amino Acid)
IGRAERSDKKPTDSPLKVRRPLEKSKTTLLAHTESTNSGQMKPPSEVSGRKLTTAGRRVP
SGSGGPLMKSQTLPRSMGRSSSQPNSSNGSYGRYPVKPASTPPAVKRQLSVPANGSPIRR
AVSGGSQRGTPTRSRTPQPTLTVRGVDPKLVQLILDEIVEGGPKVNWDR
(55 a.a.)

- SilkBase 1999-2023 -