EntryView

ORF from Assembled RNA_seq Entry

Name

O_SariMSG10154_internal:A_SariMSG_c23746_g1_i2

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_pre-mRNA-processing_factor_19_[Amyelois_transitella]

Ontology

GO:0000209	P	protein polyubiquitination
GO:0000244	P	spliceosomal tri-snRNP complex assembly
GO:0000245	P	spliceosomal complex assembly
GO:0000398	P	mRNA splicing, via spliceosome
GO:0000974	C	Prp19 complex
GO:0001833	P	inner cell mass cell proliferation
GO:0004842	F	ubiquitin-protein transferase activity
GO:0005515	F	protein binding
GO:0005634	C	nucleus
GO:0005654	C	nucleoplasm
GO:0005662	C	DNA replication factor A complex
GO:0005681	C	spliceosomal complex
GO:0005737	C	cytoplasm
GO:0005811	C	lipid droplet
GO:0005819	C	spindle
GO:0005856	C	cytoskeleton
GO:0006281	P	DNA repair
GO:0006283	P	transcription-coupled nucleotide-excision repair
GO:0006303	P	double-strand break repair via nonhomologous end joining
GO:0006397	P	mRNA processing
GO:0006974	P	cellular response to DNA damage stimulus
GO:0008380	P	RNA splicing
GO:0008610	P	lipid biosynthetic process
GO:0010498	P	proteasomal protein catabolic process
GO:0016020	C	membrane
GO:0016567	P	protein ubiquitination
GO:0016607	C	nuclear speck
GO:0016874	F	ligase activity
GO:0034450	F	ubiquitin-ubiquitin ligase activity
GO:0034613	P	cellular protein localization
GO:0035861	C	site of double-strand break
GO:0042802	F	identical protein binding
GO:0045665	P	negative regulation of neuron differentiation
GO:0048026	P	positive regulation of mRNA splicing, via spliceosome
GO:0048711	P	positive regulation of astrocyte differentiation
GO:0061630	F	ubiquitin protein ligase activity
GO:0070534	P	protein K63-linked ubiquitination
GO:0071013	C	catalytic step 2 spliceosome
GO:0072422	P	DNA damage checkpoint signaling

RNA-seq Entry

Sequence
(Amino Acid)

CALPISPTSGAVFEKRIIEKYIIENGVDPINGKELRMEDLIEIKTPPIVKPKPPSATSIP
ATLKSMQDEWDALMLHAFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALA
TLKPQAGDRKSV
(43 a.a.)

- SilkBase 1999-2023 -