SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10153_3prime_partial:A_SariMSG_c23746_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		pre-mRNA-processing_factor_19_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0000244 P spliceosomal tri-snRNP complex assembly
GO:0000245 P spliceosomal complex assembly
GO:0000398 P mRNA splicing, via spliceosome
GO:0000974 C Prp19 complex
GO:0001833 P inner cell mass cell proliferation
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005662 C DNA replication factor A complex
GO:0005681 C spliceosomal complex
GO:0005737 C cytoplasm
GO:0005811 C lipid droplet
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006397 P mRNA processing
GO:0006974 P cellular response to DNA damage stimulus
GO:0008380 P RNA splicing
GO:0008610 P lipid biosynthetic process
GO:0010498 P proteasomal protein catabolic process
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016607 C nuclear speck
GO:0016874 F ligase activity
GO:0034450 F ubiquitin-ubiquitin ligase activity
GO:0034613 P cellular protein localization
GO:0035861 C site of double-strand break
GO:0042802 F identical protein binding
GO:0045665 P negative regulation of neuron differentiation
GO:0048026 P positive regulation of mRNA splicing, via spliceosome
GO:0048711 P positive regulation of astrocyte differentiation
GO:0061630 F ubiquitin protein ligase activity
GO:0070534 P protein K63-linked ubiquitination
GO:0071013 C catalytic step 2 spliceosome
GO:0072422 P DNA damage checkpoint signaling
RNA-seq EntryA_SariMSG_c23746_g1_i1
Sequence
(Amino Acid)
MNSVSNEVPEVPVVSPTSGAVFEKRIIEKYIIENGVDPINGKELRMEDLIEIKTPPIVKP
KPPSATSIPATLKSMQDEWDALMLHAFTQRQQLQTARQELSHALYQHDAACRVIARLTKE
VTAAREALATLKPQAGDRKSV
(46 a.a.)

- SilkBase 1999-2023 -