SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG1009_internal:A_SariMSG_c5048_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		kinesin-like_protein_costa_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005119 F smoothened binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0007018 P microtubule-based movement
GO:0007224 P smoothened signaling pathway
GO:0007228 P positive regulation of hh target transcription factor activity
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008017 F microtubule binding
GO:0008134 F transcription factor binding
GO:0008152 P metabolic process
GO:0012506 C vesicle membrane
GO:0016887 F ATP hydrolysis activity
GO:0019901 F protein kinase binding
GO:0030162 P regulation of proteolysis
GO:0030707 P ovarian follicle cell development
GO:0031647 P regulation of protein stability
GO:0035301 C Hedgehog signaling complex
GO:0042073 P intraciliary transport
GO:0042803 F protein homodimerization activity
GO:0042981 P regulation of apoptotic process
GO:0042992 P obsolete negative regulation of transcription factor import into nucleus
GO:0042994 P cytoplasmic sequestering of transcription factor
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045880 P positive regulation of smoothened signaling pathway
RNA-seq EntryA_SariMSG_c5048_g1_i1
Sequence
(Amino Acid)
LTEIFHKLNQMPEREFILHVTWMQVVNNNIFDVLGAGLVRCNNVEEAFQYLQLGWRQRCQ
GNNHTIFTVSVEQKWVGTNGVLNHRMSTASFCDLAAFPDPGLYALENILKELLA
(37 a.a.)

- SilkBase 1999-2023 -