SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10094_internal:A_SariMSG_c23697_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		Protein_RIC1-like_[Papilio_xuthus]
Ontology
GO:0000139 C Golgi membrane
GO:0003674 F molecular_function
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0007411 P axon guidance
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0032483 P regulation of Rab protein signal transduction
GO:0034066 C Ric1-Rgp1 guanyl-nucleotide exchange factor complex
GO:0035418 P protein localization to synapse
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:0045467 P R7 cell development
GO:0050808 P synapse organization
GO:0060078 P regulation of postsynaptic membrane potential
GO:1903363 P negative regulation of cellular protein catabolic process
RNA-seq EntryA_SariMSG_c23697_g1_i3
Sequence
(Amino Acid)
RSEEQAEPILEDNTHVNDIEYSPLVCGFGITLNDGRAAYLTAPNLKFDPNAVQGIWAQGI
DDATCTRVNHKFRLIAIGRRNSQVDVFTIDEGTGGLELSHTMVLSSKDFPGDPGPVKCIR
WSADGRAVAVSWERGG
(44 a.a.)

- SilkBase 1999-2023 -