SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG1002_internal:A_SariMSG_c4994_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
cartilage_oligomeric_matrix_protein_isoform_X1_[Helicoverpa_armigera]
Ontology
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0005178 F integrin binding
GO:0005509 F calcium ion binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005615 C extracellular space
GO:0005783 C endoplasmic reticulum
GO:0006986 P response to unfolded protein
GO:0007155 P cell adhesion
GO:0008083 F growth factor activity
GO:0008201 F heparin binding
GO:0016525 P negative regulation of angiogenesis
GO:0016529 C sarcoplasmic reticulum
GO:0031012 C extracellular matrix
GO:0034103 P regulation of tissue remodeling
GO:0034976 P response to endoplasmic reticulum stress
GO:0048266 P behavioral response to pain
GO:0048771 P tissue remodeling
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051451 P myoblast migration
GO:0051781 P positive regulation of cell division
GO:0070062 C extracellular exosome
GO:0071603 P endothelial cell-cell adhesion
GO:0090023 P positive regulation of neutrophil chemotaxis
RNA-seq EntryA_SariMSG_c4994_g1_i1
Sequence
(Amino Acid)
HQDPNWEITNAGAEILQTLNSDPGLAVGFESFSGVDFEGTLFVDTQIDDDYVGFIFGYQN
NKRFYVVMWKKNRQTYWQTTPFRAVAEPGIQLKLVNSKTEIGRA
(33 a.a.)

- SilkBase 1999-2023 -