SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG10004_internal:A_SariMSG_c23633_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		endoribonuclease_Dicer_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000003 P reproduction
GO:0000166 F nucleotide binding
GO:0000737 P DNA catabolic process, endonucleolytic
GO:0002119 P nematode larval development
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0004386 F helicase activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004525 F ribonuclease III activity
GO:0004530 F deoxyribonuclease I activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006309 P apoptotic DNA fragmentation
GO:0006396 P RNA processing
GO:0006401 P RNA catabolic process
GO:0008355 P olfactory learning
GO:0016075 P rRNA catabolic process
GO:0016442 C RISC complex
GO:0016787 F hydrolase activity
GO:0016891 F endoribonuclease activity, producing 5'-phosphomonoesters
GO:0030422 P production of siRNA involved in RNA interference
GO:0031047 P gene silencing by RNA
GO:0031050 P dsRNA processing
GO:0031054 P pre-miRNA processing
GO:0035262 P gonad morphogenesis
GO:0040034 P regulation of development, heterochronic
GO:0046872 F metal ion binding
GO:0090501 P RNA phosphodiester bond hydrolysis
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:2000636 P positive regulation of primary miRNA processing
RNA-seq EntryA_SariMSG_c23633_g1_i1
Sequence
(Amino Acid)
PWEEEMEPIDIERNVSSATIMDIECYDEFVTSPLSATAKNVTISQPQSSTTPAIAPPPLK
YKDKIELLQKQPKGKGPELCDMLAAITTINSHDTLNLERAETLGDSFLKFFASLYLYHRF
PKMNEGQLSNIKSNMISNRNLYYAGEKFNLGGK
(50 a.a.)

- SilkBase 1999-2023 -