SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG29154_5prime_partial:A_SariMG_comp114550_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
plasmatocyte-specific_integrin_beta_1_[Manduca_sexta]
Ontology
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0001968 F fibronectin binding
GO:0002020 F protease binding
GO:0003756 F protein disulfide isomerase activity
GO:0004872 F signaling receptor activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006457 P protein folding
GO:0007044 P cell-substrate junction assembly
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0008305 C integrin complex
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0010595 P positive regulation of endothelial cell migration
GO:0010628 P positive regulation of gene expression
GO:0010745 P negative regulation of macrophage derived foam cell differentiation
GO:0010763 P positive regulation of fibroblast migration
GO:0010888 P negative regulation of lipid storage
GO:0014909 P smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016049 P cell growth
GO:0016324 C apical plasma membrane
GO:0016477 P cell migration
GO:0019899 F enzyme binding
GO:0019960 F C-X3-C chemokine binding
GO:0030054 C cell junction
GO:0030168 P platelet activation
GO:0030334 P regulation of cell migration
GO:0030335 P positive regulation of cell migration
GO:0031258 C lamellipodium membrane
GO:0031527 C filopodium membrane
GO:0031528 C microvillus membrane
GO:0031589 P cell-substrate adhesion
GO:0032147 P activation of protein kinase activity
GO:0032369 P negative regulation of lipid transport
GO:0032587 C ruffle membrane
GO:0032956 P regulation of actin cytoskeleton organization
GO:0033690 P positive regulation of osteoblast proliferation
GO:0034113 P heterotypic cell-cell adhesion
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0034679 C integrin alpha9-beta1 complex
GO:0034683 C integrin alphav-beta3 complex
GO:0036120 P cellular response to platelet-derived growth factor stimulus
GO:0038027 P apolipoprotein A-I-mediated signaling pathway
GO:0042470 C melanosome
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043184 F vascular endothelial growth factor receptor 2 binding
GO:0043235 C receptor complex
GO:0045672 P positive regulation of osteoclast differentiation
GO:0045715 P obsolete negative regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0045780 P positive regulation of bone resorption
GO:0046718 P viral entry into host cell
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048146 P positive regulation of fibroblast proliferation
GO:0048858 P cell projection morphogenesis
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050748 P negative regulation of lipoprotein metabolic process
GO:0050839 F cell adhesion molecule binding
GO:0050840 F extracellular matrix binding
GO:0050919 P negative chemotaxis
GO:0060055 P angiogenesis involved in wound healing
GO:0061097 P regulation of protein tyrosine kinase activity
GO:0070062 C extracellular exosome
GO:0070527 P platelet aggregation
GO:0071133 C alpha9-beta1 integrin-ADAM8 complex
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
GO:1903053 P regulation of extracellular matrix organization
GO:2000406 P positive regulation of T cell migration
RNA-seq EntryA_SariMG_comp114550_c0_seq1
Sequence
(Amino Acid)
KIIFAIKLKIHKTVNIDYTYLSNEILGAKYAELKEKSNIVEMIKEAYLESVRSVQLDIHK
PSSVDLIVDQDCKSEPKRNCLLPATNATLHINVTLTVKSCAKKIPEISIRPVGLTDKLIV
QVKSDCHCDCESNSDATSPRCSNFGFIQCGICKCDPFHSGKQCQCDKTSGTNEIDDLEKC
KSDPRDTDVCSGRGTCDCGLCKCDSGFSGNFCEFNDNNCPRANNKLCAGRGICHFGKCEC
EAGWIGSDCNCPNHDRDCIAPYSQEKCSGNGVCKCGQCICNKLDGKNETYTGIFCESCPE
CPDMYCKKIEDYAYCNYVNNQTYCDELPIYNKTTNTDVNIVNKTEFESPEWQMATRCKKE
LEDGGFILFKYFYEPTSHRLNLIIQKEKEMPPEANIWATVGGAIAAVILIGLLTVIAWKL
LMDMYDEREYKKFEEESRAAGFDVSLNPLYQEPAINFTNPVYSSN
*(154 a.a.)

- SilkBase 1999-2023 -