SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG29096_3prime_partial:A_SariMG_comp107955_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protein_enabled_[Bombyx_mori]
Ontology
GO:0003382 P epithelial cell morphogenesis
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0007010 P cytoskeleton organization
GO:0007015 P actin filament organization
GO:0007298 P border follicle cell migration
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007390 P germ-band shortening
GO:0007391 P dorsal closure
GO:0007396 P suture of dorsal opening
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0008064 P regulation of actin polymerization or depolymerization
GO:0008258 P head involution
GO:0008360 P regulation of cell shape
GO:0010591 P regulation of lamellipodium assembly
GO:0017124 F SH3 domain binding
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0030335 P positive regulation of cell migration
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031252 C cell leading edge
GO:0031346 P positive regulation of cell projection organization
GO:0032433 C filopodium tip
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035262 P gonad morphogenesis
GO:0042995 C cell projection
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0051489 P regulation of filopodium assembly
GO:0051491 P positive regulation of filopodium assembly
GO:0060288 P formation of a compartment boundary
GO:0071212 C subsynaptic reticulum
GO:1990255 P subsynaptic reticulum organization
RNA-seq EntryA_SariMG_comp107955_c0_seq1
Sequence
(Amino Acid)
MSEQSISSARASVMVYDDGLKKWIPSGSSSGLSKVHIYHHTQHNTFRVVGRKLNDHEVVI
NCGIVRGLKYNQATSTFHQWRDARHVYGLNFSCREDADSFARAMMHTLEILANKPSGNSA
PPPLQPPNPPVPYNGYNNTHTDEDMGYRTMTREDAAMLQQPQYHAPQHQQHQPHQQYHAQ
PTQYHAPHPHHQPQQPTPPAPPPHGVHHTLPHQPSQPTPGHHRTNSAPMPPNMSLSAVTG
AGAPPPAPPPVPPHQNLTPATNGGMAPPTPPAAPQPPPVLQQQQQQQ
(94 a.a.)

- SilkBase 1999-2023 -