SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG29025_complete:A_SariMG_comp101087_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Inhibitor_of_nuclear_factor_kappa_B_kinase_beta_subunit_[Operophtera_brumata]
Ontology
GO:0000166 F nucleotide binding
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0003009 P skeletal muscle contraction
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006954 P inflammatory response
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007252 P I-kappaB phosphorylation
GO:0008284 P positive regulation of cell population proliferation
GO:0008384 F IkappaB kinase activity
GO:0008385 C IkappaB kinase complex
GO:0009615 P response to virus
GO:0009636 P response to toxic substance
GO:0009898 C cytoplasmic side of plasma membrane
GO:0010803 P regulation of tumor necrosis factor-mediated signaling pathway
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0030866 P cortical actin cytoskeleton organization
GO:0031175 P neuron projection development
GO:0032496 P response to lipopolysaccharide
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0035509 P negative regulation of myosin-light-chain-phosphatase activity
GO:0035631 C CD40 receptor complex
GO:0035666 P TRIF-dependent toll-like receptor signaling pathway
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0042325 P regulation of phosphorylation
GO:0042493 P response to xenobiotic stimulus
GO:0042501 P serine phosphorylation of STAT protein
GO:0042803 F protein homodimerization activity
GO:0043066 P negative regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043231 C intracellular membrane-bounded organelle
GO:0045087 P innate immune response
GO:0045121 C membrane raft
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0050852 P T cell receptor signaling pathway
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051403 P stress-activated MAPK cascade
GO:0070423 P nucleotide-binding oligomerization domain containing signaling pathway
GO:0070498 P interleukin-1-mediated signaling pathway
GO:0070542 P response to fatty acid
GO:0071356 P cellular response to tumor necrosis factor
GO:0090002 P protein localization to plasma membrane
GO:0097110 F scaffold protein binding
GO:1901216 P positive regulation of neuron death
GO:1903140 P regulation of establishment of endothelial barrier
GO:1903347 P negative regulation of bicellular tight junction assembly
RNA-seq EntryA_SariMG_comp101087_c0_seq1
Sequence
(Amino Acid)
MDDIVFIGDWIKDRILGSGSFGTVVLWKNKRTDEKLAIKSCKWGDELSDKHKERWTKEVD
MLKSCENPNIVGTKQLPPEFIQGLARANPSGLPILCMEYCSGGDLRQVLNRPESCAGLKE
RQVRQILIDIGNAMQFLHQKKITHRDLKPENIVMHTLDNVEKMSSASHGNVKIIYKLIDL
GYAKEIDFNSVCASFVGTLQYLAPELLYSKTYSNSVDFWSFGLLTFEIICGQRPFLPFMS
TAQWMPYVEKKTHENICIYETFHGDIEYSNEIFPENHISKPFNKFIEKWLKVALEWDSKL
RGRDTPSRVTFNIPTQEKERASKIIIFDLLTNILSKKIIKIFSVSTLSHIAYNIDDTVTV
ERLKFWIQQDINIPPSEQILICPNTHAMLSNEAKVLNYWNDHSDVMLYLFNKIYIVKDNI
EPVVPKAVQRCLEHPKALYNFKNGFNLYRNGLYFVINQMEIYNSLINGLFIRAESLKSEG
REILLKHNSVDKDLGNLLAQEEILKRMIDTGKEQIEKLRENGIATNILHCFDIIFNGADE
LFEKINKLQNAWNQLSVRLQSAKRRCNEVISDDVKQFVNKCNFQTIYTNAYKIYIMYIKS
ESLAQNKGKEKQCHDITKVCYDCLKLRTKILLEINHQPFILKLLDLSIEFTKIVDIVKNA
ADNIEKLTNDLKVKLDELNSCMWSTINMATKDGENLSDIPYSVISFEKKGFKVGEPVSTH
CIKVTNRVQEDDKLKYLLEESLKIRKINMQLSEKLNSQKEILQKSTFDFSFLNDM
*(257 a.a.)

- SilkBase 1999-2023 -