SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG16666_complete:A_SariMG_comp30477_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001967 P suckling behavior
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007417 P central nervous system development
GO:0009791 P post-embryonic development
GO:0010259 P multicellular organism aging
GO:0010467 P gene expression
GO:0021858 P GABAergic neuron differentiation in basal ganglia
GO:0030182 P neuron differentiation
GO:0035264 P multicellular organism growth
GO:0042803 F protein homodimerization activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046983 F protein dimerization activity
RNA-seq EntryA_SariMG_comp30477_c0_seq1
Sequence
(Amino Acid)
METRHYWEENGHGVKYDNYSPSDGFTARIGGDQLNFAAHSEDEAEYPAGGYLKKGKQDPM
SHRIIEKRRRDRMNNCLADLSRLIPPEYLKKGRGRVEKTEIIEMAIRHLKYLQDRVNGT
*(39 a.a.)

- SilkBase 1999-2023 -