SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG16442_5prime_partial:A_SariMG_comp30440_c0_seq6
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000149 F SNARE binding
GO:0000775 C chromosome, centromeric region
GO:0005515 F protein binding
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005783 C endoplasmic reticulum
GO:0005813 C centrosome
GO:0006281 P DNA repair
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006914 P autophagy
GO:0006974 P cellular response to DNA damage stimulus
GO:0007051 P spindle organization
GO:0007059 P chromosome segregation
GO:0010508 P positive regulation of autophagy
GO:0017124 F SH3 domain binding
GO:0030496 C midbody
GO:0030897 C HOPS complex
GO:0032465 P regulation of cytokinesis
GO:0032801 P receptor catabolic process
GO:0035493 P SNARE complex assembly
GO:0043234 C protein-containing complex
GO:0045335 C phagocytic vesicle
GO:0046718 P viral entry into host cell
GO:0051297 P centrosome cycle
GO:0051684 P maintenance of Golgi location
GO:0060627 P regulation of vesicle-mediated transport
GO:0070418 C DNA-dependent protein kinase complex
GO:0071900 P regulation of protein serine/threonine kinase activity
GO:0071985 P multivesicular body sorting pathway
GO:0097352 P autophagosome maturation
GO:0097680 P double-strand break repair via classical nonhomologous end joining
RNA-seq EntryA_SariMG_comp30440_c0_seq6
Sequence
(Amino Acid)
RSANRCKIRINVIFNNFNYQITNFEVSSAHACLVFFSLFCLIYSSIPLFARGGDLTLFRY
ALFLMNKCIAQLLWGRGLHVTDIRPTLANLQRLLTTPSNLSETSKLFGTYRWVMDNQCPR
TQSLRSLITSDRGKYRQFNRFKDAMDGQPPQSVMNLRKHRHSRSVGSYNDDQELPTLDTS
TTSIMGSESNIYNIKLSRNDNSELITLKSHNSDSAILTLADDRSDENDVSDISYVIGDDE
KLVRISSNNDDEITLLDDNVKRICSEIAMFCSETNADVHKGFDIARHMESDIDIVRYMDS
RSSDIGDGNICVSCDMNEDGLCDLDCVKNVMSEVIVINSAEAILDTTGHSSQNVADIENS
*(119 a.a.)

- SilkBase 1999-2023 -