SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG15978_complete:A_SariMG_comp30394_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003677 F DNA binding
GO:0003910 F DNA ligase (ATP) activity
GO:0003950 F NAD+ ADP-ribosyltransferase activity
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0005719 C euchromatin
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006273 P lagging strand elongation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006471 P protein ADP-ribosylation
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0007000 P nucleolus organization
GO:0007552 P metamorphosis
GO:0008069 P dorsal/ventral axis specification, ovarian follicular epithelium
GO:0008270 F zinc ion binding
GO:0009303 P rRNA transcription
GO:0015030 C Cajal body
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0030576 P Cajal body organization
GO:0035079 P polytene chromosome puffing
GO:0035080 P heat shock-mediated polytene chromosome puffing
GO:0035363 C histone locus body
GO:0042393 F histone binding
GO:0043484 P regulation of RNA splicing
GO:0045087 P innate immune response
GO:0046872 F metal ion binding
GO:0048812 P neuron projection morphogenesis
GO:0051103 P DNA ligation involved in DNA repair
GO:0051276 P chromosome organization
GO:0051287 F NAD binding
GO:0051457 P maintenance of protein location in nucleus
GO:1900182 P positive regulation of protein localization to nucleus
RNA-seq EntryA_SariMG_comp30394_c0_seq1
Sequence
(Amino Acid)
MADLPYQAEYAKTGRASCKGCKQKIDQGTLRLAVMVQSAFHDGKQPNWHHEDCFFKKQRP
QNFNDIGNFNKLKNDDQKRIKSMIENSTGIVMPAAETKGKGKKRAATNSSAANASALKDF
LIEYSKSSRATCRHCEIKICKDEVRISKTVYDTEVGSKYGGQPLWHHVKCFAECRSNLLY
FAGGESLPGFDKLKKEDQELVKNEIKPFKSDEVPVKKLKDEPKDEAELKEEKKKEKEMEK
QNKLFQKYKKSLSDLTKNDLAEILEYNSQEVFFWKKRKKKKWKNRINYFRSTKNL
*(97 a.a.)

- SilkBase 1999-2023 -