SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG15964_complete:A_SariMG_comp30390_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001664 F G protein-coupled receptor binding
GO:0004197 F cysteine-type endopeptidase activity
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005776 C autophagosome
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005925 C focal adhesion
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006897 P endocytosis
GO:0007411 P axon guidance
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008270 F zinc ion binding
GO:0008277 P regulation of G protein-coupled receptor signaling pathway
GO:0009267 P cellular response to starvation
GO:0010506 P regulation of autophagy
GO:0016477 P cell migration
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0017160 F small GTPase binding
GO:0032091 P negative regulation of protein binding
GO:0032092 P positive regulation of protein binding
GO:0036459 F thiol-dependent deubiquitinase
GO:0044297 C cell body
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050821 P protein stabilization
GO:0051298 P centrosome duplication
GO:0070536 P protein K63-linked deubiquitination
GO:0071108 P protein K48-linked deubiquitination
RNA-seq EntryA_SariMG_comp30390_c1_seq2
Sequence
(Amino Acid)
MRLRTRRARELAAFCELHATFQEQDRPRAIYAISMHWFRQWQAFVRNKTQQVPPPVDNTG
IVIKQEINGTTTYSLKQGSDHAQLSEELWRFFTDIYGGGPEVRLKSPNLQTLEPTPVPCE
NRQPDNIRLSRKCSASDREEYCSKSTSEVNIRDTIEGERLQKNQSLQNINRRVVTASRNI
DSDDDVNYRFTYKRHERNGNYQDSDEEDVIPSRGYANTIVRTENGIDNSDYDSNDNRNRS
DTELPDMGNISLRNNKQSKAGGKVRKMKRKTVK
*(90 a.a.)

- SilkBase 1999-2023 -