SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG15522_complete:A_SariMG_comp30314_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000255 P allantoin metabolic process
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001553 P luteinization
GO:0001666 P response to hypoxia
GO:0001779 P natural killer cell differentiation
GO:0001889 P liver development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006101 P citrate metabolic process
GO:0006103 P 2-oxoglutarate metabolic process
GO:0006105 P succinate metabolic process
GO:0006107 P oxaloacetate metabolic process
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006549 P isoleucine metabolic process
GO:0006573 P valine metabolic process
GO:0006600 P creatine metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006953 P acute-phase response
GO:0007165 P signal transduction
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0007548 P sex differentiation
GO:0007565 P female pregnancy
GO:0007595 P lactation
GO:0008284 P positive regulation of cell population proliferation
GO:0019218 P regulation of steroid metabolic process
GO:0019221 P cytokine-mediated signaling pathway
GO:0019530 P taurine metabolic process
GO:0019903 F protein phosphatase binding
GO:0019915 P lipid storage
GO:0030155 P regulation of cell adhesion
GO:0030856 P regulation of epithelial cell differentiation
GO:0032355 P response to estradiol
GO:0032496 P response to lipopolysaccharide
GO:0032819 P positive regulation of natural killer cell proliferation
GO:0032825 P positive regulation of natural killer cell differentiation
GO:0032870 P cellular response to hormone stimulus
GO:0033077 P T cell differentiation in thymus
GO:0035259 F glucocorticoid receptor binding
GO:0038161 P prolactin signaling pathway
GO:0040014 P regulation of multicellular organism growth
GO:0040018 P positive regulation of multicellular organism growth
GO:0042104 P positive regulation of activated T cell proliferation
GO:0042448 P progesterone metabolic process
GO:0043029 P T cell homeostasis
GO:0043066 P negative regulation of apoptotic process
GO:0043434 P response to peptide hormone
GO:0043565 F sequence-specific DNA binding
GO:0045086 P positive regulation of interleukin-2 production
GO:0045471 P response to ethanol
GO:0045579 P positive regulation of B cell differentiation
GO:0045588 P positive regulation of gamma-delta T cell differentiation
GO:0045621 P positive regulation of lymphocyte differentiation
GO:0045647 P negative regulation of erythrocyte differentiation
GO:0045931 P positive regulation of mitotic cell cycle
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0045954 P positive regulation of natural killer cell mediated cytotoxicity
GO:0046449 P creatinine metabolic process
GO:0046543 P development of secondary female sexual characteristics
GO:0046544 P development of secondary male sexual characteristics
GO:0046983 F protein dimerization activity
GO:0048541 P Peyer's patch development
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0050729 P positive regulation of inflammatory response
GO:0051272 P positive regulation of cellular component movement
GO:0060397 P growth hormone receptor signaling pathway via JAK-STAT
GO:0070669 P response to interleukin-2
GO:0070670 P response to interleukin-4
GO:0070672 P response to interleukin-15
GO:0071363 P cellular response to growth factor stimulus
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0097531 P mast cell migration
RNA-seq EntryA_SariMG_comp30314_c0_seq1
Sequence
(Amino Acid)
MSLWTRAQQLPQESLQKVRMIYVDHFPIEVRHCLAPWIESRIWAAGPEDQQRTFVNDLVQ
EIQTHADLMLSPDMFVTKMKLLEAAKNFHLQYSHAPHELYAYMRRCLALEMEVIQNAMGT
QYVAQPQTERKYSELITGLQTVRQKVSMAGEEIRSLQGNIEAFSLQWHECLKNKGHMNYL
QQSMTNERRDLVACLRSQIEETERKLNALVAQISQSQMELVDHMKDNIANLRQLQSQVLD
DELIKWKREQQLSGNGVPMQSNLNTIQEWCELLADLIWTTRQQVTNVARINTKTIVELRQ
PHLAEMLDDMSKQVTGLLSTLVTSTFVIEKQPPQVMKTNTRFTATVRLLVGGQLNVYMTP
PRVSVVIISEQQAQLLLKSETQAGKGKQPVECGDILNNTGTMEYQPTSRQLSVSFRNMQL
RKIKRAEKKGTESVMDEKLTLLFQSQFNVGGGELVFQVWTLSLPVVVIVHGNQEPHGWAT
VTWDNAFSPPGRVPFAVPDKVTWGQLAETLSLKFSSATGGSLSEDNLRFLAEKIFRTNLP
INTMELNAMAISWTQFCKDALPERNFTFWEWFYMVVKVTRDYLRALWCDRLIMGFIQKKQ
AEDMLSKCPPGTFLLRFSDSELGGITIAWTGEGNEVFSLQPFTSRDLMLRSLADRVFDLT
QLQFLYPNIPKDDVFSKYYTKPENEMLKNGYVKPVLVTTLPPYMSSSPAYAHSPDSHRNT
PSVHSSYFSAATPTQADSFMDSELFEQIRAFEPDGLDDFDIYSNMSMK
*(255 a.a.)

- SilkBase 1999-2023 -