SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG1541_complete:A_SariMG_comp15836_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		caspase-6_[Spodoptera_exigua]
Ontology
GO:0001666 P response to hypoxia
GO:0001782 P B cell homeostasis
GO:0002020 F protease binding
GO:0004190 F aspartic-type endopeptidase activity
GO:0004197 F cysteine-type endopeptidase activity
GO:0004861 F cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0005123 F death receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006309 P apoptotic DNA fragmentation
GO:0006508 P proteolysis
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006921 P cellular component disassembly involved in execution phase of apoptosis
GO:0006974 P cellular response to DNA damage stimulus
GO:0007507 P heart development
GO:0007605 P sensory perception of sound
GO:0007611 P learning or memory
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008635 P activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
GO:0008656 F cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0009411 P response to UV
GO:0009611 P response to wounding
GO:0009749 P response to glucose
GO:0010033 P response to organic substance
GO:0010038 P response to metal ion
GO:0010165 P response to X-ray
GO:0014070 P response to organic cyclic compound
GO:0016005 F phospholipase A2 activator activity
GO:0016241 P regulation of macroautophagy
GO:0016485 P protein processing
GO:0016787 F hydrolase activity
GO:0021766 P hippocampus development
GO:0030182 P neuron differentiation
GO:0030216 P keratinocyte differentiation
GO:0030218 P erythrocyte differentiation
GO:0030220 P platelet formation
GO:0030889 P negative regulation of B cell proliferation
GO:0031264 C death-inducing signaling complex
GO:0032025 P response to cobalt ion
GO:0032355 P response to estradiol
GO:0032403 F protein-containing complex binding
GO:0032496 P response to lipopolysaccharide
GO:0034349 P glial cell apoptotic process
GO:0034612 P response to tumor necrosis factor
GO:0035094 P response to nicotine
GO:0035329 P hippo signaling
GO:0035556 P intracellular signal transduction
GO:0042060 P wound healing
GO:0042493 P response to xenobiotic stimulus
GO:0042542 P response to hydrogen peroxide
GO:0043029 P T cell homeostasis
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043085 P positive regulation of catalytic activity
GO:0043200 P response to amino acid
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045121 C membrane raft
GO:0045165 P cell fate commitment
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045786 P negative regulation of cell cycle
GO:0046007 P negative regulation of activated T cell proliferation
GO:0046677 P response to antibiotic
GO:0048011 P neurotrophin TRK receptor signaling pathway
GO:0051384 P response to glucocorticoid
GO:0051402 P neuron apoptotic process
GO:0071310 P cellular response to organic substance
GO:0071407 P cellular response to organic cyclic compound
GO:0097153 F cysteine-type endopeptidase activity involved in apoptotic process
GO:0097190 P apoptotic signaling pathway
GO:0097192 P extrinsic apoptotic signaling pathway in absence of ligand
GO:0097194 P execution phase of apoptosis
GO:0097200 F cysteine-type endopeptidase activity involved in execution phase of apoptosis
RNA-seq EntryA_SariMG_comp15836_c0_seq1
Sequence
(Amino Acid)
MWQTDAIYHQSLPTEQLISNNDIINVDAISAIDRELQDNVYDMTSLVFLLYEVPDTALQK
LIVYQRIAKDATGTNLNLLHEWYQHAKARSTWKHEFIEALLICQLYNIVRRLGLHVPTMK
RYYQSDVTTFSMHINPLRKLLYKACENMTSDNLGKLKRSLKSYNVEVGEHDVCELIFLEL
MCQKFIKVNYVSHEKKKLSSEINVEKLVRIMSNLSGLRNIAMELKDLQDKSDNKVTDVQS
ASQVVEDSSMFSEEPGVDNINDKFDNTNFQDMLSKFGDLNLDHLSDENLKSDTTNLFKDG
YKIKDPKKIGICLIINQENFFPSKYSIESYNQKDSLDPRLGSTADKLLLEKTMTDLSFTV
YSYSDLDHKEMIECIKKTIKSVNKNDSVFMLCILSHGVRGHVYAADSVKIKVEDIQHLLD
SDEAKHLRGVPKVLVIQACQVDDKSECALVADGTSDYHLRKSDFLVYWATAPEYEAYRHE
KYGSLFIQLLCMMIKQYARRAHLYEIFTKVTNKVTSVCTKLQRAQVPLFESTLRKNLYIQ
LPK
*(180 a.a.)

- SilkBase 1999-2023 -