SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMG14_internal:A_SariMG_comp1763_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_synaptotagmin-10-like_[Amyelois_transitella]
Ontology
GO:0005509 F calcium ion binding
GO:0005544 F calcium-dependent phospholipid binding
GO:0005886 C plasma membrane
GO:0006906 P vesicle fusion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017158 P regulation of calcium ion-dependent exocytosis
GO:0019905 F syntaxin binding
GO:0030054 C cell junction
GO:0030141 C secretory granule
GO:0030276 F clathrin binding
GO:0030667 C secretory granule membrane
GO:0030672 C synaptic vesicle membrane
GO:0031045 C dense core granule
GO:0031410 C cytoplasmic vesicle
GO:0042802 F identical protein binding
GO:0045202 C synapse
GO:0045956 P positive regulation of calcium ion-dependent exocytosis
GO:0046872 F metal ion binding
GO:0048791 P calcium ion-regulated exocytosis of neurotransmitter
GO:0050796 P regulation of insulin secretion
GO:0070382 C exocytic vesicle
RNA-seq EntryA_SariMG_comp1763_c0_seq1
Sequence
(Amino Acid)
ELMLSLCYLPTAGRLTVTVIKGRNLKAMDINGSSDPYVKICLICQGKRIKKKKTTVKKNT
LCPVYNEALVFDLPSENVFDVTLLIKVIDYDRLSPNELIGCTAIGSSLIGIGREHWLE
(38 a.a.)

- SilkBase 1999-2023 -