SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG14723_complete:A_SariMG_comp30188_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000993 F RNA polymerase II complex binding
GO:0001764 P neuron migration
GO:0002098 P tRNA wobble uridine modification
GO:0003824 F catalytic activity
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0007417 P central nervous system development
GO:0008023 C transcription elongation factor complex
GO:0008080 F N-acetyltransferase activity
GO:0008607 F phosphorylase kinase regulator activity
GO:0010484 F H3 histone acetyltransferase activity
GO:0010485 F H4 histone acetyltransferase activity
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0030335 P positive regulation of cell migration
GO:0033588 C elongator holoenzyme complex
GO:0043966 P histone H3 acetylation
GO:0043967 P histone H4 acetylation
GO:0045859 P regulation of protein kinase activity
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
RNA-seq EntryA_SariMG_comp30188_c0_seq2
Sequence
(Amino Acid)
MYKIVAHMMPDLPNVDFERDVEQFVEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRY
RSYPPSTLVDLIAKVLALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMADLGTD
CRDVRTREVGIQEIHNRVKPYEVELVRRDYVANGGWETFLAYEDPDQDILVGLLRLRKCA
SDTYRPELKPGPNADFKRCSIVRELHVYGSVVPVNARDPTKFQHQGFGMLLMEEAERIAK
EEHGSDKMAVISGVGTRNYYAKIGYHLEGPYMVKMLV
*(91 a.a.)

- SilkBase 1999-2023 -