SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG14541_internal:A_SariMG_comp30146_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0000910 P cytokinesis
GO:0003777 F microtubule motor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0007018 P microtubule-based movement
GO:0007049 P cell cycle
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008333 P endosome to lysosome transport
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016887 F ATP hydrolysis activity
GO:0030496 C midbody
GO:0032438 P melanosome organization
GO:0032588 C trans-Golgi network membrane
GO:0035459 P vesicle cargo loading
GO:0043001 P Golgi to plasma membrane protein transport
GO:0051301 P cell division
GO:0072383 P plus-end-directed vesicle transport along microtubule
RNA-seq EntryA_SariMG_comp30146_c0_seq2
Sequence
(Amino Acid)
AAPAVPPAHPAAPAGAPLSPRHQPQVTFRFDHRQDFTIPLTEEFIEHCAEGALSIEVWGH
RSAGFSRSRGNWEVEQQQLAKARSLADRWAELTRKIELWVEIHELNDQGEYAPVEVAIRN
DMLTGGVYQLRQGQQRRLAVRVRPAQNSGTLPIICQHIVSVEVGSVTVRSRLQKPLDSYQ
EEDLAVLRERWSDALARRRQHLHAQLQKLVNMSPSMKSERDMEREQSLVEQWVSLTEERN
(79 a.a.)

- SilkBase 1999-2023 -