SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMG14448_complete:A_SariMG_comp30127_c2_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007254 P JNK cascade
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007300 P ovarian nurse cell to oocyte transport
GO:0007301 P female germline ring canal formation
GO:0007349 P cellularization
GO:0007391 P dorsal closure
GO:0007411 P axon guidance
GO:0007424 P open tracheal system development
GO:0007435 P salivary gland morphogenesis
GO:0007611 P learning or memory
GO:0007616 P long-term memory
GO:0008064 P regulation of actin polymerization or depolymerization
GO:0008302 P female germline ring canal formation, actin assembly
GO:0008335 P female germline ring canal stabilization
GO:0008355 P olfactory learning
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016319 P mushroom body development
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030036 P actin cytoskeleton organization
GO:0030046 P parallel actin filament bundle assembly
GO:0030708 P germarium-derived female germ-line cyst encapsulation
GO:0030717 P oocyte karyosome formation
GO:0030723 P ovarian fusome organization
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0034332 P adherens junction organization
GO:0036058 P filtration diaphragm assembly
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0045087 P innate immune response
GO:0045172 C germline ring canal
GO:0045860 P positive regulation of protein kinase activity
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0048477 P oogenesis
GO:0090136 P epithelial cell-cell adhesion
RNA-seq EntryA_SariMG_comp30127_c2_seq2
Sequence
(Amino Acid)
MGNKCCSRRHDPERPLVYPAYKNEAGFTTCPTSLETRYTGEPNTRVLSRPPADIVRNPGK
SVSNGGRRVVKALCAYAARADTDISFRKGDRMEVLNDTEPDWWRVLHLTTRQQGLVPVNF
VAEESSVECEDWFFPHVSRKEADKLLLAESNPRGTFLVRPAEHNPHGFSLSVKDWEEERG
YHVKHYKIKPLDNGGFYIATNQTFPSLPALVMSYTKNALGL
*(73 a.a.)

- SilkBase 1999-2023 -